PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000248210
Common NameGATA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 374aa    MW: 40859.4 Da    PI: 6.7833
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000248210genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.95.6e-18259293135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  MDP0000248210 259 CMHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 293
                    99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.8E-8118349IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.36253289IPR000679Zinc finger, GATA-type
SMARTSM004011.5E-16253303IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-14255290IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.14E-15255317No hitNo description
CDDcd002022.00E-14258305No hitNo description
PfamPF003207.8E-16259293IPR000679Zinc finger, GATA-type
PROSITE patternPS003440259284IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MEAPEYYKKT FCPQFTPEKR HSFDSSNNKT AVGGGGDHFM VEDLLDFSND DDAVITDGGC  60
PAAFDNVIGN STDSSPLNVI DSCNSSSLSG SEPNFGSRNL ADGPFSSDLC VPCDDLAELE  120
WLSNFVEESF SSEDLQKLQL ISGMKPRPDQ AAFETSQFQP DPTLTNNNPN GNNNPIFNPE  180
VSVPAKARSK RSRAAPCNWT SRLLLLSTPE QSDVVVSAAE AASPLPPPSS TGKKTVKSAP  240
KKKESQEGSG GGPGDGRKCM HCATDKTPQW RTGPMGPKTL CNACGVRYKS GRLVPEYRPA  300
ASPTFVLTKH SNSHRKVLEL RRQKEIVRAQ QTFIHQVPPP HHHHHHHQNM VFDVSNGGDY  360
LIHQHVGPDF RQLI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.108280.0bud| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008378072.10.0PREDICTED: GATA transcription factor 12-like
SwissprotP697811e-97GAT12_ARATH; GATA transcription factor 12
TrEMBLD9ZIY70.0D9ZIY7_MALDO; GATA domain class transcription factor
STRINGVIT_04s0008g03270.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.19e-83GATA transcription factor 12